DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp44a and Obp83a

DIOPT Version :9

Sequence 1:NP_001286186.1 Gene:Obp44a / 35789 FlyBaseID:FBgn0033268 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_001287190.1 Gene:Obp83a / 40737 FlyBaseID:FBgn0011281 Length:174 Species:Drosophila melanogaster


Alignment Length:109 Identity:26/109 - (23%)
Similarity:47/109 - (43%) Gaps:18/109 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AVAILLCALLGLASA-----------SDYK----LRTAEDLQSARKECAASSKVTEALIAKYKTF 53
            :.::||.||..|:.|           .:|.    |:.|:....|   |...:.||||.|.::...
  Fly    31 SASVLLIALSLLSGALILPPAAAQRDENYPPPGILKMAKPFHDA---CVEKTGVTEAAIKEFSDG 92

  Fly    54 DYPDDDITRNYIQCIFVKFDLFDEAKGFKVENLVAQLGQGKEDK 97
            :..:|:..:.|:.|.|.:.::.|:.....:|.|.|.:.....||
  Fly    93 EIHEDEKLKCYMNCFFHEIEVVDDNGDVHLEKLFATVPLSMRDK 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp44aNP_001286186.1 PhBP 32..132 CDD:214783 17/66 (26%)
Obp83aNP_001287190.1 PBP_GOBP 64..166 CDD:279703 19/76 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452900
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105360at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.