DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp44a and Obp47a

DIOPT Version :9

Sequence 1:NP_001286186.1 Gene:Obp44a / 35789 FlyBaseID:FBgn0033268 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_610632.1 Gene:Obp47a / 36162 FlyBaseID:FBgn0033573 Length:165 Species:Drosophila melanogaster


Alignment Length:104 Identity:21/104 - (20%)
Similarity:35/104 - (33%) Gaps:37/104 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NAVAILLCAL----------------LGLASASDYKLRTAEDLQSARKECAASSKVTEALIAKYK 51
            |.|.:||..|                |||..|.:......|::   .:.|...:.::...:.|.:
  Fly     2 NRVLVLLLVLKMFALSESRFAKININLGLTVADESPKTITEEM---IRLCGDQTDISLRELNKLQ 63

  Fly    52 TFDYPDDDITRNYIQC---------------IFVKFDLF 75
            ..|:.|..   ..:||               :||:.|||
  Fly    64 REDFSDPS---ESVQCFTHCLYEQMGLMHDGVFVERDLF 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp44aNP_001286186.1 PhBP 32..132 CDD:214783 11/59 (19%)
Obp47aNP_610632.1 PBP_GOBP 48..132 CDD:279703 11/55 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.