DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp44a and Obp19d

DIOPT Version :9

Sequence 1:NP_001286186.1 Gene:Obp44a / 35789 FlyBaseID:FBgn0033268 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_523421.2 Gene:Obp19d / 33040 FlyBaseID:FBgn0011280 Length:150 Species:Drosophila melanogaster


Alignment Length:120 Identity:27/120 - (22%)
Similarity:46/120 - (38%) Gaps:18/120 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLCALLGLASASDYKLRTAEDLQSARKECAASSKVTEALIAKYKTFDYPDDDITRNYIQCIFVKF 72
            :||  ||..||..::....:.......||.|.:..|:..:.:..:.|.|:....:....|:..|.
  Fly    15 ILC--LGATSAKPHEEINRDHAAELANECKAETGATDEDVEQLMSHDLPERHEAKCLRACVMKKL 77

  Fly    73 DLFDEAKGFKVENLVAQLGQGKEDKAALKADIEKCADKNEQKSPANEWAFRGFKC 127
            .:.||:.....|:.:..:      |...|.|.||      :.:||...|    ||
  Fly    78 QIMDESGKLNKEHAIELV------KVMSKHDAEK------EDAPAEVVA----KC 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp44aNP_001286186.1 PhBP 32..132 CDD:214783 21/96 (22%)
Obp19dNP_523421.2 PBP_GOBP 23..139 CDD:279703 22/110 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452912
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.