DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp44a and Obp19c

DIOPT Version :9

Sequence 1:NP_001286186.1 Gene:Obp44a / 35789 FlyBaseID:FBgn0033268 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_608392.1 Gene:Obp19c / 33039 FlyBaseID:FBgn0031111 Length:175 Species:Drosophila melanogaster


Alignment Length:112 Identity:23/112 - (20%)
Similarity:41/112 - (36%) Gaps:27/112 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DYKLRTAEDL-QSARKECAAS----------SKVTEALIAKYKTFDYPDDDITRNYIQCIFVKFD 73
            |..|...::| .:||.||...          .|||.           |.:. .:..::|:..|..
  Fly    52 DRNLPQVQELVTAARMECIQKLQLPRDQRPLGKVTN-----------PSEK-EKCLVECVLKKIK 104

  Fly    74 LFDEAKGF---KVENLVAQLGQGKEDKAALKADI-EKCADKNEQKSP 116
            |.|.....   :||.|.:.:.|..:...|:.:.: :.|:.....|:|
  Fly   105 LMDADNKLNVGQVEKLTSLVTQDNKMAIAVSSSMAQACSRGISSKNP 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp44aNP_001286186.1 PhBP 32..132 CDD:214783 20/99 (20%)
Obp19cNP_608392.1 PhBP 65..164 CDD:214783 20/99 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.