DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp44a and Obp51a

DIOPT Version :9

Sequence 1:NP_001286186.1 Gene:Obp44a / 35789 FlyBaseID:FBgn0033268 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_725436.1 Gene:Obp51a / 246666 FlyBaseID:FBgn0043530 Length:117 Species:Drosophila melanogaster


Alignment Length:132 Identity:27/132 - (20%)
Similarity:45/132 - (34%) Gaps:43/132 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILLCALLGLASASDYKLRTAEDLQSARKECAASSKVTEALIAKYKTFDYPDDDITRNYIQCIFVK 71
            :||.|:..|:||.         .:|...|||....:|.....     ::|.....:.:..|...|
  Fly     8 VLLLAVTTLSSAL---------FESEANECAKKLGITPDYFE-----NFPHSSRVKCFYHCQMEK 58

  Fly    72 FDL--------FDEAKGFKVENLVAQLGQGKEDKAALKADIEKCADKNEQKSPANEWAFRGFKCF 128
            .::        ||    .||.|:..:    ..||..:|  ::.|...:.:.           ||.
  Fly    59 LEIIANGVVTPFD----LKVLNISPE----SYDKYGVK--VKPCLKLSHRD-----------KCE 102

  Fly   129 LG 130
            ||
  Fly   103 LG 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp44aNP_001286186.1 PhBP 32..132 CDD:214783 20/107 (19%)
Obp51aNP_725436.1 PBP_GOBP 25..114 CDD:279703 20/106 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.