DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp44a and Obp83g

DIOPT Version :9

Sequence 1:NP_001286186.1 Gene:Obp44a / 35789 FlyBaseID:FBgn0033268 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_731043.1 Gene:Obp83g / 170878 FlyBaseID:FBgn0046875 Length:146 Species:Drosophila melanogaster


Alignment Length:140 Identity:42/140 - (30%)
Similarity:70/140 - (50%) Gaps:9/140 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AVAILLCALLGLASASDYKLRTAEDLQSARKECAASSKVTEALIAKYKTFDYPDDDITRNYIQCI 68
            |||..|.|    .:.:.:.|:...|.:.|.:||.....|.:.:..||..:::|....|..:::|.
  Fly    12 AVATFLVA----QTTAKFLLKDHADAEKAFEECREDYYVPDDIYEKYLNYEFPAHRRTSCFVKCF 72

  Fly    69 FVKFDLFDEAKGFKVENLVAQL-GQGKEDKAALKADIEKCADKNEQKSPANEWAFRGFKCFLGKN 132
            ..|.:||.|.|||....::||. .:..:|.:.::..:|||.|.||.:|....||.|.|.|:    
  Fly    73 LEKLELFSEKKGFDERAMIAQFTSKSSKDLSTVQHGLEKCIDHNEAESDVCTWANRVFSCW---- 133

  Fly   133 LPLVQAAVQK 142
            ||:.:..|:|
  Fly   134 LPINRHVVRK 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp44aNP_001286186.1 PhBP 32..132 CDD:214783 31/100 (31%)
Obp83gNP_731043.1 PBP_GOBP 22..134 CDD:279703 33/115 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450209
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FBJK
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105360at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.