DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and ZCRB1

DIOPT Version :10

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_149105.3 Gene:ZCRB1 / 85437 HGNCID:29620 Length:217 Species:Homo sapiens


Alignment Length:138 Identity:37/138 - (26%)
Similarity:52/138 - (37%) Gaps:27/138 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 MAGGSTTGLATVPLSLEEKQEIDTRSVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHP 136
            |:||.....:|               |||.|:.:..:..:|...|...|.:.:|||:.:|.....
Human     1 MSGGLAPSKST---------------VYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKS 50

  Fly   137 KGFAYIEFGSKEFVE--TALAMNETLFRGRQIKVMSKRTNRPGLSTTNRFARGSFR-------GR 192
            ||.|:|.|..|:..:  |....|:.|| ||.||......|........|  |..|.       |.
Human    51 KGVAFILFLDKDSAQNCTRAINNKQLF-GRVIKASIAIDNGRAAEFIRR--RNYFDKSKCYECGE 112

  Fly   193 GARVSRAC 200
            ...:|.||
Human   113 SGHLSYAC 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488
RRM_II_PABPN1 97..172 CDD:409966 25/76 (33%)
ZCRB1NP_149105.3 RRM_ZCRB1 9..84 CDD:409827 26/90 (29%)
PTZ00368 <97..123 CDD:173561 7/26 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..217 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.