DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and SR30

DIOPT Version :10

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_172386.3 Gene:SR30 / 837433 AraportID:AT1G09140 Length:268 Species:Arabidopsis thaliana


Alignment Length:121 Identity:27/121 - (22%)
Similarity:48/121 - (39%) Gaps:18/121 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RSVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMNETL 160
            |::||||:.......|:|..|:..|.|..:.:   |....|.|:|::||......:.|:...:..
plant     7 RTIYVGNLPGDIRKCEVEDLFYKYGPIVDIDL---KIPPRPPGYAFVEFEDPRDADDAIYGRDGY 68

  Fly   161 -FRGRQIKVMSKRTNRPGLSTTNRFARGSFRGRGARVSRACCHSTFRGARRAMGYR 215
             |.|.:::|......|....:.:|::..              :|..|...|...||
plant    69 DFDGCRLRVEIAHGGRRFSPSVDRYSSS--------------YSASRAPSRRSDYR 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488
RRM_II_PABPN1 97..172 CDD:409966 19/75 (25%)
SR30NP_172386.3 RRM_SF 8..79 CDD:473069 19/73 (26%)
RRM2_SF2_plant_like 109..184 CDD:410014 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.