DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and SC35

DIOPT Version :10

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_201225.1 Gene:SC35 / 836541 AraportID:AT5G64200 Length:303 Species:Arabidopsis thaliana


Alignment Length:153 Identity:40/153 - (26%)
Similarity:65/153 - (42%) Gaps:32/153 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 DTRSVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETAL-AMN 157
            ||.|:.|.|:.:..:|::|...|...|.:..|.|..::..|..:|||::.:..|:....|: .::
plant    14 DTYSLLVLNITFRTTADDLYPLFAKYGKVVDVFIPRDRRTGDSRGFAFVRYKYKDEAHKAVERLD 78

  Fly   158 ETLFRGRQIKV-----------MSK-------------RTNRPGLSTTNRFARGSFRGRGARVSR 198
            ..:..||:|.|           :||             |:..|..|.:.|.:|...|.|..|.||
plant    79 GRVVDGREITVQFAKYGPNAEKISKGRVVEPPPKSRRSRSRSPRRSRSPRRSRSPPRRRSPRRSR 143

  Fly   199 ACCHSTFRGAR---RAMGYRGRA 218
                |..|.:|   |...||.|:
plant   144 ----SPRRRSRDDYREKDYRKRS 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488
RRM_II_PABPN1 97..172 CDD:409966 21/99 (21%)
SC35NP_201225.1 RRM_SRSF2_SRSF8 18..90 CDD:409751 17/71 (24%)
PHA03307 <204..>303 CDD:223039
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.