DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and PABN1

DIOPT Version :9

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001190511.1 Gene:PABN1 / 835186 AraportID:AT5G51120 Length:265 Species:Arabidopsis thaliana


Alignment Length:257 Identity:95/257 - (36%)
Similarity:129/257 - (50%) Gaps:76/257 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EETNGEQETEIATEVEEE--------GSMQIDP-----ELEAIKARVKEMEEEAEKIKQMQSEVD 69
            ||..||.:||   |.||.        |..:::|     :||.:|.|:||:||||..:::||::.:
plant    18 EEEEGEMDTE---EYEEHGGEEGAAAGDEELEPGSSSRDLEDMKKRIKEIEEEAGALREMQAKAE 79

  Fly    70 KQMAGGSTTGLATVPL-------------------------------------SLEEKQEIDTRS 97
            |.|  |::.||..|.|                                     |..||:|:|:||
plant    80 KDM--GASQGLKLVLLIMILLWVYILESFSESMNLSRNLLEFEYEKEIINSGVSAAEKEEVDSRS 142

  Fly    98 VYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMNETLFR 162
            :|||||||..:.||::.||..|||:||||||.:|. |.||||||:||...|.|:.:|.:||:...
plant   143 IYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKF-GQPKGFAYVEFVEVEAVQNSLILNESELH 206

  Fly   163 GRQIKVMSKRTNRPGLSTTNRFARGSFRGRGARVSRACCHSTFRGARRAMGYRGRANYYAPY 224
            ||||||.:||||.||:.        .|||||            |..|...|:.....:|.||
plant   207 GRQIKVSAKRTNVPGMR--------QFRGRG------------RPFRPMRGFMPGVPFYPPY 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 RRM <43..>172 CDD:223796 67/165 (41%)
RRM_II_PABPN1 97..172 CDD:240994 42/74 (57%)
PABN1NP_001190511.1 RRM <101..>265 CDD:223796 65/169 (38%)
RRM_II_PABPs 142..213 CDD:240752 41/71 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 86 1.000 Domainoid score I2786
eggNOG 1 0.900 - - E1_KOG4209
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 150 1.000 Inparanoid score I1715
OMA 1 1.010 - - QHG53866
OrthoDB 1 1.010 - - D1412946at2759
OrthoFinder 1 1.000 - - FOG0001228
OrthoInspector 1 1.000 - - otm2915
orthoMCL 1 0.900 - - OOG6_101686
Panther 1 1.100 - - O PTHR23236
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X689
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.