DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and Cstf2t

DIOPT Version :10

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_112539.2 Gene:Cstf2t / 83410 MGIID:1932622 Length:632 Species:Mus musculus


Alignment Length:77 Identity:26/77 - (33%)
Similarity:45/77 - (58%) Gaps:7/77 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RSVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALA----M 156
            |||:|||:.|.|:.|:|:..|...|::....::.::..|.|||:.:.|:..:   ||||:    :
Mouse    16 RSVFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCEYQDQ---ETALSAMRNL 77

  Fly   157 NETLFRGRQIKV 168
            |...|.||.::|
Mouse    78 NGREFSGRALRV 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488
RRM_II_PABPN1 97..172 CDD:409966 25/76 (33%)
Cstf2tNP_112539.2 RRM_CSTF2_CSTF2T 10..94 CDD:410072 26/77 (34%)
CSTF2_hinge 112..191 CDD:433869
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..296
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..433
8 X 5 AA tandem repeats of M-E-T-R-[AG] 428..466
12 X 5 AA tandem repeats of G-[AT]-G-[MI]-Q 508..565
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 519..590
CSTF_C 588..628 CDD:464130
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.