DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and AT5G03480

DIOPT Version :9

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_195968.1 Gene:AT5G03480 / 831825 AraportID:AT5G03480 Length:321 Species:Arabidopsis thaliana


Alignment Length:176 Identity:37/176 - (21%)
Similarity:64/176 - (36%) Gaps:34/176 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LESLEETNGEQETEIATEVEEEGSMQIDPELEAIKARV------------------KEMEEEAEK 60
            |:|| |.|...:...:|.:..||   .|..|:....|:                  ::.:::..|
plant     9 LKSL-ELNDSDKQSTSTAICVEG---YDTSLKEYPLRLALTKHFASCGEITQIYVPRDFKKKILK 69

  Fly    61 ------IKQMQSEVDKQMAGGSTTGLATVPLSLEEKQEIDTRSVYVGNVDYGASAEE------LE 113
                  ||...:|.......|:..|..||.:..:.|.|..:....:....|..|.::      ||
plant    70 SVSFMWIKGEGAEDKALQLSGTDVGGWTVIVKPKPKHEPPSPITTISVEGYDTSLQKYLLELILE 134

  Fly   114 AHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMNET 159
            .||..||.|..|.:..:...|..|..|::....:...:.||.::.|
plant   135 KHFDSCGEIRHVYVPTDYERGVLKSVAFLRIEGEGAEDKALQLSGT 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 RRM <43..>172 CDD:223796 28/147 (19%)
RRM_II_PABPN1 97..172 CDD:240994 16/69 (23%)
AT5G03480NP_195968.1 RRM_SF 26..102 CDD:302621 13/78 (17%)
RRM_SF 114..192 CDD:302621 16/67 (24%)
RRM_SF 217..284 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23236
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.