DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and AT5G10350

DIOPT Version :9

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_196597.1 Gene:AT5G10350 / 830899 AraportID:AT5G10350 Length:217 Species:Arabidopsis thaliana


Alignment Length:217 Identity:90/217 - (41%)
Similarity:124/217 - (57%) Gaps:40/217 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EQETEI-ATEVEEEGSMQI-DP-------------ELEAIKARVKEMEEEAEKIKQMQSEVDKQM 72
            |:|.|: ..|:.|.|...: ||             ||..:|.|:|||||||..:::||::|:|:|
plant     3 EEEHEVYGGEIPEVGDTDVPDPDIDMSAADEDAVTELAEMKRRLKEMEEEAAALREMQAKVEKEM 67

  Fly    73 AGGSTTGLATVPLSLEEKQEIDTRSVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPK 137
              |:|...|::..:.|.|:|:|.||||||||||..:.||::.||..|||:||||||.:|. |.||
plant    68 --GATQDPASMAANQEGKEEVDARSVYVGNVDYACTPEEVQLHFQTCGTVNRVTILMDKF-GQPK 129

  Fly   138 GFAYIEFGSKEFVETALAMNETLFRGRQIKVMSKRTNRPGLSTTNRFARGSFRGRGARVSRACCH 202
            ||||:||...|.|:.||.:||:...|||:||..||||.||:   .::..|.|             
plant   130 GFAYVEFVEVEAVQEALQLNESELHGRQLKVSPKRTNVPGM---KQYHPGRF------------- 178

  Fly   203 STFRGARRAMGYRGRANYYAPY 224
                  ..:||||.|..:..||
plant   179 ------NPSMGYRFRRPFVPPY 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 RRM <43..>172 CDD:223796 67/128 (52%)
RRM_II_PABPN1 97..172 CDD:240994 43/74 (58%)
AT5G10350NP_196597.1 PIN_SF <6..70 CDD:421694 23/65 (35%)
RRM <47..>212 CDD:223796 78/173 (45%)
RRM_II_PABPs 90..161 CDD:409747 42/71 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 86 1.000 Domainoid score I2786
eggNOG 1 0.900 - - E1_KOG4209
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3412
Inparanoid 1 1.050 150 1.000 Inparanoid score I1715
OMA 1 1.010 - - QHG53866
OrthoDB 1 1.010 - - D1412946at2759
OrthoFinder 1 1.000 - - FOG0001228
OrthoInspector 1 1.000 - - otm2915
orthoMCL 1 0.900 - - OOG6_101686
Panther 1 1.100 - - O PTHR23236
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X689
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.