DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and SR34b

DIOPT Version :10

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001328194.1 Gene:SR34b / 828027 AraportID:AT4G02430 Length:292 Species:Arabidopsis thaliana


Alignment Length:134 Identity:34/134 - (25%)
Similarity:55/134 - (41%) Gaps:27/134 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 TRSVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMNET 159
            :|::||||:.......|:|..|...|.:.::.:   |....|.|:|::||......:.|:...:.
plant     6 SRTIYVGNLPGDIREREVEDLFSKYGPVVQIDL---KIPPRPPGYAFVEFEDARDADDAIYGRDG 67

  Fly   160 L-FRGRQIKVMSKRTNRPGLSTTNRFARGSFRGRGARVSRACCHSTFRGAR-------RAMGYRG 216
            . |.|..::|......|    .::..||||:.|||            ||.|       |..|...
plant    68 YDFDGHHLRVELAHGGR----RSSHDARGSYSGRG------------RGGRGGGDGGGRERGPSR 116

  Fly   217 RANY 220
            |:.|
plant   117 RSEY 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488
RRM_II_PABPN1 97..172 CDD:409966 18/75 (24%)
SR34bNP_001328194.1 RRM1_SF2_plant_like 8..79 CDD:410011 18/73 (25%)
RRM2_SF2_plant_like 120..192 CDD:410014 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.