DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and SR34a

DIOPT Version :10

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_190512.3 Gene:SR34a / 824105 AraportID:AT3G49430 Length:300 Species:Arabidopsis thaliana


Alignment Length:134 Identity:37/134 - (27%)
Similarity:56/134 - (41%) Gaps:38/134 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 TRSVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMNET 159
            :||:||||:.......|:|..|:..|.|..:.:   |....|..:.::||......|.|:     
plant     6 SRSIYVGNLPGDIREHEIEDIFYKYGRIVDIEL---KVPPRPPCYCFVEFEHSRDAEDAI----- 62

  Fly   160 LFRGR--------QIKVMSKRTNRPGLSTTNRFARGSFRGRG------------AR--VSRACCH 202
              :||        :::|......| |.|:::|  ||.:.|.|            ||  |||   |
plant    63 --KGRDGYNLDGCRLRVELAHGGR-GQSSSDR--RGGYGGGGSGYGGGGGGGGSARFGVSR---H 119

  Fly   203 STFR 206
            |.||
plant   120 SEFR 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488
RRM_II_PABPN1 97..172 CDD:409966 19/82 (23%)
SR34aNP_190512.3 RRM_SF 9..79 CDD:473069 18/79 (23%)
RRM2_SF2_plant_like 122..197 CDD:410014 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.