DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and GRP4

DIOPT Version :10

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_189025.1 Gene:GRP4 / 821966 AraportID:AT3G23830 Length:136 Species:Arabidopsis thaliana


Alignment Length:99 Identity:25/99 - (25%)
Similarity:47/99 - (47%) Gaps:12/99 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 VYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETAL-AMNETLF 161
            ::||.:.:|.....|:..|...|.:...|::.::..|..:||.::.|..::....|: .|:....
plant    37 LFVGGLSWGTDDSSLKQAFTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAIKEMDGKEL 101

  Fly   162 RGRQIKV--MSKRTNRPGLSTTNRFARGSFRGRG 193
            .||||:|  .::|::.|         |.||.|.|
plant   102 NGRQIRVNLATERSSAP---------RSSFGGGG 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488
RRM_II_PABPN1 97..172 CDD:409966 18/76 (24%)
GRP4NP_189025.1 PLN03134 1..122 CDD:178680 21/93 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.