DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and AT2G27330

DIOPT Version :10

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_565646.2 Gene:AT2G27330 / 817276 AraportID:AT2G27330 Length:116 Species:Arabidopsis thaliana


Alignment Length:71 Identity:24/71 - (33%)
Similarity:39/71 - (54%) Gaps:1/71 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 SVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETA-LAMNETL 160
            :::|..:.:.::.|.|...|...|.:.:|.::.:|....||||||:.|.|||..|.| |.:|..|
plant    22 TLFVKGISFSSTEETLTQAFSQYGQVLKVDVIMDKIRCRPKGFAYVTFSSKEEAEKALLELNAQL 86

  Fly   161 FRGRQI 166
            ..||.:
plant    87 VDGRVV 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488
RRM_II_PABPN1 97..172 CDD:409966 24/71 (34%)
AT2G27330NP_565646.2 RRM_SF 23..99 CDD:473069 24/70 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.