DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and SRSF7

DIOPT Version :10

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001026854.1 Gene:SRSF7 / 6432 HGNCID:10789 Length:238 Species:Homo sapiens


Alignment Length:158 Identity:50/158 - (31%)
Similarity:61/158 - (38%) Gaps:50/158 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 VYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMNETLFR 162
            |||||:..||...|||..|...|.:..|.|..|     |.|||::||......|.|:       |
Human    13 VYVGNLGTGAGKGELERAFSYYGPLRTVWIARN-----PPGFAFVEFEDPRDAEDAV-------R 65

  Fly   163 GRQIKVMSKRTNRPGLST----TNRF----ARGSF-----------------------RGRGARV 196
            |...||:.....|..|||    .:||    ||..|                       |.|.:| 
Human    66 GLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHRYSRRRRSR- 129

  Fly   197 SRACCHSTFRGAR------RAMGYRGRA 218
            ||:..||..||.|      |:.|.|.|:
Human   130 SRSRSHSRSRGRRYSRSRSRSRGRRSRS 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488
RRM_II_PABPN1 97..172 CDD:409966 27/73 (37%)
SRSF7NP_001026854.1 RRM_SRSF7 12..88 CDD:410050 31/86 (36%)
Sufficient for interaction with NXF1 81..98 6/16 (38%)
zf-CCHC 104..119 CDD:395050 0/14 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 123..238 14/36 (39%)
6 X 8 AA repeats of R-R-S-R-S-X-S-X 153..226 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.