DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and SRSF3

DIOPT Version :10

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_003008.1 Gene:SRSF3 / 6428 HGNCID:10785 Length:164 Species:Homo sapiens


Alignment Length:127 Identity:34/127 - (26%)
Similarity:52/127 - (40%) Gaps:18/127 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 VYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEF-GSKEFVETALAMNETLF 161
            |||||:....:..|||..|...|.:..|.:..|     |.|||::|| ..::..:....::....
Human    12 VYVGNLGNNGNKTELERAFGYYGPLRSVWVARN-----PPGFAFVEFEDPRDAADAVRELDGRTL 71

  Fly   162 RGRQIKVM----SKRT-NRPGLSTTNRFARGSFRGRGARVSRACCHSTFRGARRAMGYRGRA 218
            .|.:::|.    .||: ||....:..|..|..:|.|.....|       |..||....|.|:
Human    72 CGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRR-------RSPRRRSFSRSRS 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488
RRM_II_PABPN1 97..172 CDD:409966 20/78 (26%)
SRSF3NP_003008.1 Sufficient for interaction with NXF1 and SRSP. /evidence=ECO:0000269|PubMed:12667464, ECO:0000269|PubMed:17036044, ECO:0000269|PubMed:32440474 1..90 22/82 (27%)
RRM_SRSF3 6..86 CDD:241089 20/78 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..164 14/53 (26%)
2 X approximate repeats, basic 119..164 2/8 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.