DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and RBM3

DIOPT Version :10

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_006734.1 Gene:RBM3 / 5935 HGNCID:9900 Length:157 Species:Homo sapiens


Alignment Length:141 Identity:42/141 - (29%)
Similarity:62/141 - (43%) Gaps:27/141 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 LSLEEKQEIDTRSVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEF 149
            :|.||.:      ::||.:::....:.||.||...|.|:.|.::.::.....:||.:|.|.:.|.
Human     1 MSSEEGK------LFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEH 59

  Fly   150 VETAL-AMNETLFRGRQIKVMSKRTNRPGLSTTNRFARG---SFRGRGARVSRACCHSTFRGARR 210
            ...|: |||.....||||:|     :..|.|.  |..||   ...|||...||.       |..:
Human    60 ASVAMRAMNGESLDGRQIRV-----DHAGKSA--RGTRGGGFGAHGRGRSYSRG-------GGDQ 110

  Fly   211 AMGYRGRANYY 221
              || |...||
Human   111 --GY-GSGRYY 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488
RRM_II_PABPN1 97..172 CDD:409966 23/75 (31%)
RBM3NP_006734.1 RRM_CIRBP_RBM3 6..85 CDD:409883 24/89 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..157 16/50 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.