DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and cirbp

DIOPT Version :10

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001017228.1 Gene:cirbp / 549982 XenbaseID:XB-GENE-492781 Length:166 Species:Xenopus tropicalis


Alignment Length:139 Identity:43/139 - (30%)
Similarity:66/139 - (47%) Gaps:13/139 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 DTRSVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETA-LAMN 157
            |...::||.:::..:.|.||..|...|.:..|.::.::.....:||.::.|.:.|..:.| :|||
 Frog     4 DEGKLFVGGLNFETTEESLEQVFSKYGQVAEVVVVKDRESKRSRGFGFVTFENPEDAKDAMMAMN 68

  Fly   158 ETLFRGRQIKV--MSKRTN------RPGLSTTNRFARGSFRGRGARVSRACCHSTFRGARRAMGY 214
            .....||||:|  ..|.:|      |.|.|....|.||. ||||....|....|: |...|:.||
 Frog    69 GKSVDGRQIRVDQAGKSSNDRRGGYRGGSSGGRGFFRGG-RGRGGGGDRGYGGSS-RFENRSGGY 131

  Fly   215 R--GRANYY 221
            :  |..:||
 Frog   132 QSSGSRDYY 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488
RRM_II_PABPN1 97..172 CDD:409966 21/77 (27%)
cirbpNP_001017228.1 RRM_CIRBP_RBM3 6..85 CDD:409883 21/78 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..166 27/75 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.