DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and pabpn1l

DIOPT Version :9

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001016352.1 Gene:pabpn1l / 549106 XenbaseID:XB-GENE-1000600 Length:218 Species:Xenopus tropicalis


Alignment Length:217 Identity:107/217 - (49%)
Similarity:141/217 - (64%) Gaps:33/217 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SLEETNGEQETEIATEVEEEGSMQIDPELEAIKARVKEMEEEAEKIKQMQSE------------- 67
            ||::.:|.:|.::.           ||||:||:.||:|||||||::|.:..|             
 Frog    10 SLDKGDGAEECDLD-----------DPELKAIRMRVREMEEEAERLKGLSGEDKSIGVSSRPCMK 63

  Fly    68 -VDKQMAGGSTTGLATVPLSLEEKQEIDTRSVYVGNVDYGASAEELEAHFHGCGTINRVTILCNK 131
             :..:|..|:.|.....|||.|||:|||.|||||||||||.:|::|||||..||:|||:||||:|
 Frog    64 LIHSKMTAGAYTEGPPRPLSAEEKKEIDKRSVYVGNVDYGGTAQDLEAHFSSCGSINRITILCDK 128

  Fly   132 ADGHPKGFAYIEFGSKEFVETALAMNETLFRGRQIKVMSKRTNRPGLSTTNRFARGSFRGRGARV 196
            ..|||||:|||||..:..|:.|:||:||:||||.|||:.||||.||:|||:   ||.|||| .|.
 Frog   129 FSGHPKGYAYIEFAERNSVDVAVAMDETVFRGRTIKVLPKRTNMPGISTTD---RGGFRGR-PRG 189

  Fly   197 SRACCHSTFRGAR-RAMGYRGR 217
            :|.   :..||.| |...:|||
 Frog   190 NRG---NYQRGQRPRGRPFRGR 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 RRM <43..>172 CDD:223796 77/142 (54%)
RRM_II_PABPN1 97..172 CDD:240994 49/74 (66%)
pabpn1lNP_001016352.1 RRM_II_PABPN1L 94..170 CDD:240995 50/75 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412946at2759
OrthoFinder 1 1.000 - - FOG0001228
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X689
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.