DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and Pabpn1

DIOPT Version :9

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_062275.1 Gene:Pabpn1 / 54196 MGIID:1859158 Length:302 Species:Mus musculus


Alignment Length:218 Identity:129/218 - (59%)
Similarity:156/218 - (71%) Gaps:20/218 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GEQETEIATEVEEEGSMQI--------DPELEAIKARVKEMEEEAEKIKQMQSEVDKQMAGGSTT 78
            |.||.|     ||.|.::.        |||||||||||:||||||||:|::|:||:|||......
Mouse    90 GSQEEE-----EEPGLVEADPGDGAIEDPELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPP 149

  Fly    79 GLA-TVPLSLEEKQEIDTRSVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYI 142
            |.| .|.:|||||.|.|.||:|||||||||:||||||||||||::|||||||:|..|||||||||
Mouse   150 GNAGPVIMSLEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYI 214

  Fly   143 EFGSKEFVETALAMNETLFRGRQIKVMSKRTNRPGLSTTNR-FARGSFRGRGARV--SRACCHST 204
            ||..||.|.|:||::|:|||||||||:.|||||||:|||:| |.|..:|.|....  ||:..:|.
Mouse   215 EFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRSRYRARTTNYNSSRSRFYSG 279

  Fly   205 FRGARRAMGYRGRA---NYYAPY 224
            |....|...|||||   ::|:||
Mouse   280 FNSRPRGRIYRGRARATSWYSPY 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 RRM <43..>172 CDD:223796 92/129 (71%)
RRM_II_PABPN1 97..172 CDD:240994 57/74 (77%)
Pabpn1NP_062275.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..111 7/25 (28%)
Interaction with SKIP. /evidence=ECO:0000250 2..141 30/55 (55%)
RRM 109..>285 CDD:223796 113/175 (65%)
Stimulates PAPOLA. /evidence=ECO:0000250 115..143 21/27 (78%)
RRM_II_PABPN1 169..244 CDD:240994 57/74 (77%)
Strong poly(A) affinity and self-association. /evidence=ECO:0000250 255..302 16/46 (35%)
Interaction with PAPOLA. /evidence=ECO:0000250 282..302 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840080
Domainoid 1 1.000 123 1.000 Domainoid score I5599
eggNOG 1 0.900 - - E1_KOG4209
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3412
Inparanoid 1 1.050 231 1.000 Inparanoid score I3433
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412946at2759
OrthoFinder 1 1.000 - - FOG0001228
OrthoInspector 1 1.000 - - oto95364
orthoMCL 1 0.900 - - OOG6_101686
Panther 1 1.100 - - LDO PTHR23236
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4120
SonicParanoid 1 1.000 - - X689
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.