DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and RBM11

DIOPT Version :10

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001307531.1 Gene:RBM11 / 54033 HGNCID:9897 Length:288 Species:Homo sapiens


Alignment Length:91 Identity:32/91 - (35%)
Similarity:45/91 - (49%) Gaps:6/91 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 QEIDTRSVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALA 155
            ||...|:|:|||::.....|.|...|...|.:.:||| |...:|.||.|.::.|...|.|..|:|
Human     5 QEEADRTVFVGNLEARVREEILYELFLQAGPLTKVTI-CKDREGKPKSFGFVCFKHPESVSYAIA 68

  Fly   156 -MNETLFRGRQIKVM----SKRTNRP 176
             :|.....||.|.|.    |.|::.|
Human    69 LLNGIRLYGRPINVQYRFGSSRSSEP 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488
RRM_II_PABPN1 97..172 CDD:409966 27/79 (34%)
RBM11NP_001307531.1 RRM_RBM11 9..83 CDD:410006 26/74 (35%)
PABP-1234 <12..223 CDD:130689 29/84 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.