DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and SC35

DIOPT Version :10

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster


Alignment Length:153 Identity:44/153 - (28%)
Similarity:64/153 - (41%) Gaps:12/153 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 GGSTTGLATVPLSLEEKQEIDTR-SVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPK 137
            ||...||.    :......||.. |:.|.|:.|..:.|:|...|..||.:..:.|..::.....:
  Fly     4 GGGAGGLG----AARPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESR 64

  Fly   138 GFAYIEFGSKEFVETAL-AMNETLFRGRQIKVMSKRTNRPGLSTTNRFAR------GSFRGRGAR 195
            |||::.|..|...|.|| ||:..:..||:::|...|..||...|.:...|      |...||...
  Fly    65 GFAFVRFYDKRDAEDALEAMDGRMLDGRELRVQMARYGRPSSPTRSSSGRRGGGGGGGSGGRRRS 129

  Fly   196 VSRACCHSTFRGARRAMGYRGRA 218
            .||:......|..||....|.|:
  Fly   130 RSRSPMRRRSRSPRRRSYSRSRS 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488
RRM_II_PABPN1 97..172 CDD:409966 23/75 (31%)
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 21/71 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.