DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and srsf3

DIOPT Version :10

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_012815513.1 Gene:srsf3 / 448605 XenbaseID:XB-GENE-490817 Length:183 Species:Xenopus tropicalis


Alignment Length:127 Identity:35/127 - (27%)
Similarity:53/127 - (41%) Gaps:18/127 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 VYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEF-GSKEFVETALAMNETLF 161
            |||||:....:..|||..|...|.:..|.:..|     |.|||::|| ..::..:....::....
 Frog    31 VYVGNLGNNGNKTELERAFGYYGPLRSVWVARN-----PPGFAFVEFEDPRDAADAVRELDGRTL 90

  Fly   162 RGRQIKVM----SKRT-NRPGLSTTNRFARGSFRGRGARVSRACCHSTFRGARRAMGYRGRA 218
            .|.:::|.    .||: ||....:.||..|..:|.|.....|       |..||....|.|:
 Frog    91 CGCRVRVELSNGEKRSRNRGPPPSWNRRPRDDYRRRSPPPRR-------RSPRRRSFSRSRS 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488
RRM_II_PABPN1 97..172 CDD:409966 20/78 (26%)
srsf3XP_012815513.1 RRM_SRSF3 25..105 CDD:241089 20/78 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.