DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and msi

DIOPT Version :10

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_733108.2 Gene:msi / 43087 FlyBaseID:FBgn0011666 Length:634 Species:Drosophila melanogaster


Alignment Length:146 Identity:30/146 - (20%)
Similarity:61/146 - (41%) Gaps:31/146 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 VPLSLEEKQEID---------------TRSVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKA 132
            ||:...:.::||               |:.::||.|....||||::|:|...|.:....:|.::.
  Fly   263 VPIHTLDGKKIDPKHATPKNRPRQANKTKKIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQ 327

  Fly   133 DGHPKGFAYIEFGSKEFVETALAMNETLFRGRQI---------------KVMSKRTNRPGLSTTN 182
            ....:||.::.|.:::.|:....::....:.:::               :::.||.....|....
  Fly   328 TKRHRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKAQPKEAVTPAAQLLQKRIMLGTLGVQL 392

  Fly   183 RFARGSFRG-RGARVS 197
            ..|.|...| |||.|:
  Fly   393 PTAPGQLIGARGAGVA 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488
RRM_II_PABPN1 97..172 CDD:409966 15/89 (17%)
msiNP_733108.2 RRM_SF 204..278 CDD:473069 4/14 (29%)
RRM2_MSI 292..365 CDD:240769 15/72 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.