DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and CG6937

DIOPT Version :9

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_651066.2 Gene:CG6937 / 42662 FlyBaseID:FBgn0038989 Length:356 Species:Drosophila melanogaster


Alignment Length:157 Identity:34/157 - (21%)
Similarity:64/157 - (40%) Gaps:34/157 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 KARVKEMEEEAEKIK-----------QMQSEVDK---QMAGGSTTGLATVPLSLEEKQEIDTRSV 98
            |.:.:::|:::...|           |::.:|.|   |...|...|:                 |
  Fly     6 KPKAQKIEKQSTPKKPIDAAKNVVSGQLKKKVTKARPQKPKGPERGV-----------------V 53

  Fly    99 YVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMNETLFRG 163
            .|.::.:|...::|..:|...|.:.||.:..:...|:.||:|::||   |:.|.|....:|:...
  Fly    54 IVKHLPHGFFEQQLRQYFRQFGRVLRVRLARSLRTGNSKGYAFVEF---EYPEVAKVAADTMDNY 115

  Fly   164 RQIKVMSKRTNRPGLSTTNRFARGSFR 190
            ...:.:.|.|..|....|..|.|.|.:
  Fly   116 LMFQKVVKATYIPPEKQTLNFFRTSLK 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 RRM <43..>172 CDD:223796 27/137 (20%)
RRM_II_PABPN1 97..172 CDD:240994 18/74 (24%)
CG6937NP_651066.2 RRM <32..>170 CDD:223796 31/131 (24%)
RRM_NIFK_like 52..125 CDD:240753 19/92 (21%)
Upf2 253..>304 CDD:281974
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468335
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.