DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and Rbp1

DIOPT Version :10

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster


Alignment Length:97 Identity:34/97 - (35%)
Similarity:45/97 - (46%) Gaps:12/97 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 VYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETAL-AMNETLF 161
            |||||:...||..|:|..|...|.:..|.:..|     |.|||::||..:...|.|. |::.|..
  Fly    13 VYVGNLGSSASKHEIEGAFAKYGPLRNVWVARN-----PPGFAFVEFEDRRDAEDATRALDGTRC 72

  Fly   162 RGRQIKV-MSKRTNRPGLSTTNRFARGSFRGR 192
            .|.:|:| ||.     |.|...|...|...||
  Fly    73 CGTRIRVEMSS-----GRSRDRRRGEGGSSGR 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488
RRM_II_PABPN1 97..172 CDD:409966 28/75 (37%)
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 26/72 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.