DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and pabpn1

DIOPT Version :9

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001001230.1 Gene:pabpn1 / 407911 XenbaseID:XB-GENE-1007049 Length:296 Species:Xenopus tropicalis


Alignment Length:223 Identity:129/223 - (57%)
Similarity:158/223 - (70%) Gaps:21/223 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EDQLLESLE--ETNGEQETEIATEVEEEGSMQIDPELEAIKARVKEMEEEAEKIKQMQSEVDKQM 72
            ||:.||..|  |..|:|..|             |||||||||||:||||||||:|::|:||:|||
 Frog    87 EDEELEEEEPGELTGDQTIE-------------DPELEAIKARVREMEEEAEKLKELQNEVEKQM 138

  Fly    73 AGGSTTGLA-TVPLSLEEKQEIDTRSVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHP 136
            ......|.| .|.:|:|||.|.|.||:|||||||||:||||||||||||::|||||||:|..|||
 Frog   139 NMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKYTGHP 203

  Fly   137 KGFAYIEFGSKEFVETALAMNETLFRGRQIKVMSKRTNRPGLSTTNR-FARGSFRGRGARV-SRA 199
            ||||||||..||.|.|:||::|:|||||||||:.|||||||:|||:| |.|..:|.|.:.. ||:
 Frog   204 KGFAYIEFSDKESVRTSLALDESLFRGRQIKVVPKRTNRPGISTTDRGFPRARYRARASSYSSRS 268

  Fly   200 CCHSTFRGARRAMGYRGRA---NYYAPY 224
            ..:|.:....|...|||||   ::|.||
 Frog   269 RFYSGYTPRPRGRVYRGRARVTSWYTPY 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 RRM <43..>172 CDD:223796 91/129 (71%)
RRM_II_PABPN1 97..172 CDD:240994 57/74 (77%)
pabpn1NP_001001230.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..102 6/14 (43%)
Necessary for homooligomerization. /evidence=ECO:0000250|UniProtKB:Q86U42 146..296 91/149 (61%)
RRM_II_PABPN1 164..239 CDD:240994 57/74 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 123 1.000 Domainoid score I5526
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 230 1.000 Inparanoid score I3366
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412946at2759
OrthoFinder 1 1.000 - - FOG0001228
OrthoInspector 1 1.000 - - oto105540
Panther 1 1.100 - - LDO PTHR23236
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4120
SonicParanoid 1 1.000 - - X689
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.100

Return to query results.
Submit another query.