DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and pabpn1

DIOPT Version :9

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_998424.1 Gene:pabpn1 / 406543 ZFINID:ZDB-GENE-040426-2401 Length:284 Species:Danio rerio


Alignment Length:233 Identity:129/233 - (55%)
Similarity:158/233 - (67%) Gaps:33/233 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADEDITLNEDQLLES------LEETN-GEQETEIATEVEEEGSMQI-DPELEAIKARVKEMEEE 57
            ||:....|.|:.||:|      ||:.. |::|..:     :||...| |||||||||||:|||||
Zfish     1 MAEFGNGLAEESLLDSDPGHSELEDPGVGDEEPGL-----DEGEAAIEDPELEAIKARVREMEEE 60

  Fly    58 AEKIKQMQSEVDKQMAGGSTTGLATVPLSLEEKQEIDTRSVYVGNVDYGASAEELEAHFHGCGTI 122
            |||:|::|:||:||| ..|......|.:|:|||.|.|.||:|||||||||:||||||||||||::
Zfish    61 AEKLKELQNEVEKQM-NLSPPPAGPVIMSIEEKIEADGRSIYVGNVDYGATAEELEAHFHGCGSV 124

  Fly   123 NRVTILCNKADGHPKGFAYIEFGSKEFVETALAMNETLFRGRQIKVMSKRTNRPGLSTTNR-FAR 186
            |||||||:|..|||||||||||..||.|.||:|::|:|||||||||.:|||||||:|||:| |.|
Zfish   125 NRVTILCDKFTGHPKGFAYIEFADKESVRTAMALDESLFRGRQIKVGAKRTNRPGISTTDRGFPR 189

  Fly   187 GSFRGRGARVSRACCHSTFRGARRAMGYRGRANYYAPY 224
            ..||.||...|                  .||.||:.|
Zfish   190 ARFRSRGGNFS------------------SRARYYSGY 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 RRM <43..>172 CDD:223796 90/128 (70%)
RRM_II_PABPN1 97..172 CDD:240994 57/74 (77%)
pabpn1NP_998424.1 PLN03134 74..209 CDD:178680 90/153 (59%)
RRM_II_PABPN1 99..174 CDD:240994 57/74 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170584252
Domainoid 1 1.000 123 1.000 Domainoid score I5565
eggNOG 1 0.900 - - E1_KOG4209
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 221 1.000 Inparanoid score I3526
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412946at2759
OrthoFinder 1 1.000 - - FOG0001228
OrthoInspector 1 1.000 - - oto40583
orthoMCL 1 0.900 - - OOG6_101686
Panther 1 1.100 - - LDO PTHR23236
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4120
SonicParanoid 1 1.000 - - X689
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.