DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and Pabpn1l

DIOPT Version :9

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001007463.1 Gene:Pabpn1l / 382035 MGIID:2685954 Length:273 Species:Mus musculus


Alignment Length:244 Identity:92/244 - (37%)
Similarity:126/244 - (51%) Gaps:42/244 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ADEDITLNEDQ--LLESLEETNGEQETEIATEVEEEGSMQIDPELEAIKARV------------- 51
            :|::...|||.  ||..||..|..:            |...:.||||||.::             
Mouse    51 SDKEAEENEDASFLLSLLEPENLAK------------SPVFNQELEAIKLKLWAMEHAEAQPEPP 103

  Fly    52 ----KEMEEEAEKIKQMQSEVDKQMAGGSTTGLATVPLSLEEKQEIDTRSVYVGNVDYGASAEEL 112
                |..|||..:::|:.|..........|:         :|..|.|.|||:|||||||.||.||
Mouse   104 CVQRKATEEERAEVRQLLSPETVDCFFSRTS---------KENVEADHRSVFVGNVDYGGSAAEL 159

  Fly   113 EAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMNETLFRGRQIKVMSKRTNRPG 177
            ||:|..||.|:||||||:|..|||||:|||||.|...|:.|:.::|:.||||.|||:.||||.||
Mouse   160 EAYFSPCGEIHRVTILCDKFSGHPKGYAYIEFASHRSVKAAVGLDESTFRGRVIKVLPKRTNFPG 224

  Fly   178 LSTTNRFARGSFRGRGARVSRACCH--STFRGARRAMGYRGRANYYAPY 224
            :|:|:|....:..|..|.......|  :..|...|:.|:.|...:::||
Mouse   225 ISSTDRGGLRTHSGNRAAFLHGSLHRKARLRAHGRSRGHGGAPQWFSPY 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 RRM <43..>172 CDD:223796 64/145 (44%)
RRM_II_PABPN1 97..172 CDD:240994 47/74 (64%)
Pabpn1lNP_001007463.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..57 1/5 (20%)
RRM <134..>227 CDD:223796 57/101 (56%)
RRM_SF 144..220 CDD:302621 48/75 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4209
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001228
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X689
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.870

Return to query results.
Submit another query.