DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and CG11454

DIOPT Version :10

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster


Alignment Length:99 Identity:25/99 - (25%)
Similarity:47/99 - (47%) Gaps:8/99 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 EEKQEIDTRSVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVET 152
            :|:::.:.|:::.||:|...:.|.|...|...|.|..|.|..:. :|.|:.|.::.:.....|..
  Fly    62 DEEEDEEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPTDN-NGRPRNFGFVTYQRLCAVPF 125

  Fly   153 ALAMNETLFRGRQI---KVMSKRTNRPGLSTTNR 183
            ||    .|::|.::   ||..|:.....|...|:
  Fly   126 AL----DLYQGLELFQKKVTIKQQGGKQLPAYNQ 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488
RRM_II_PABPN1 97..172 CDD:409966 20/77 (26%)
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:409773 21/78 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.