DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and Rbp1-like

DIOPT Version :10

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001188585.1 Gene:Rbp1-like / 32293 FlyBaseID:FBgn0030479 Length:247 Species:Drosophila melanogaster


Alignment Length:98 Identity:33/98 - (33%)
Similarity:45/98 - (45%) Gaps:15/98 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 VYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETAL-AMNETLF 161
            |||||:...||..|:|..|...|.:..|.:..|     |.|||::||..:...|.|. .::.|..
  Fly    13 VYVGNLGSSASKYEIENAFSKYGPLRNVWVARN-----PPGFAFVEFEDRRDAEDATRGLDGTRC 72

  Fly   162 RGRQIKV-MSKRTNRPGLSTTNRFARGSFRGRG 193
            .|.:|:| ||...:|.|        ||...|.|
  Fly    73 CGTRIRVEMSSGRSREG--------RGGGGGGG 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488
RRM_II_PABPN1 97..172 CDD:409966 27/75 (36%)
Rbp1-likeNP_001188585.1 RRM_SRSF3_like 12..81 CDD:409808 25/72 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.