DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and Pabpn1l

DIOPT Version :9

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001107251.1 Gene:Pabpn1l / 307920 RGDID:1562761 Length:269 Species:Rattus norvegicus


Alignment Length:247 Identity:98/247 - (39%)
Similarity:135/247 - (54%) Gaps:48/247 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ADEDITLNEDQ--LLESLEETNGEQETEIATEVEEEGSMQIDPELEAIKARVKEMEE-----EAE 59
            :|::...|||.  ||..||..|..:            |...:.|||||:.::..||.     |..
  Rat    47 SDKEAEENEDSSFLLSLLEPENLAK------------SPVYNQELEAIRLKLWTMEHAEVLPEPP 99

  Fly    60 KIKQMQSEVD----KQMAGGSTTGLATVPLSLEEKQEIDTRSVYVGNVDYGASAEELEAHFHGCG 120
            .:::..:|.:    :::....|.| ...|.:.:|..|.|.|||||||||||.||.||||:|..||
  Rat   100 SVQRKATEEERAEARELLSPETIG-CFFPGAPKENVEADHRSVYVGNVDYGGSAAELEAYFSPCG 163

  Fly   121 TINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMNETLFRGRQIKVMSKRTNRPGLSTTNR-- 183
            .|:||||||:|..|||||:|||||.||..|:.|:.::|:.||||.|||:.||||.||:|:|:|  
  Rat   164 EIHRVTILCDKFSGHPKGYAYIEFASKSSVQAAVRLDESTFRGRVIKVLPKRTNFPGISSTDRGG 228

  Fly   184 ----------FARGSFRGRGARVSRACCHSTFRGARRAMGYRGRAN-YYAPY 224
                      |.:||.:    |..|...|...||       ||||: :::||
  Rat   229 LRTHSSSRAAFLQGSLQ----RKPRLRPHGQSRG-------RGRASPWFSPY 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 RRM <43..>172 CDD:223796 65/137 (47%)
RRM_II_PABPN1 97..172 CDD:240994 49/74 (66%)
Pabpn1lNP_001107251.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..54 1/6 (17%)
RRM <129..>223 CDD:223796 59/93 (63%)
RRM_SF 140..216 CDD:302621 50/75 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..269 11/39 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I11691
eggNOG 1 0.900 - - E1_KOG4209
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412946at2759
OrthoFinder 1 1.000 - - FOG0001228
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23236
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X689
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.880

Return to query results.
Submit another query.