DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and DAZAP1

DIOPT Version :10

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_011526206.1 Gene:DAZAP1 / 26528 HGNCID:2683 Length:550 Species:Homo sapiens


Alignment Length:93 Identity:21/93 - (22%)
Similarity:44/93 - (47%) Gaps:8/93 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 TRSVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMNET 159
            :..::||.:.:.....||..:|...|.:..|.::.:.....|:||.:|.|..::.|:.|:.|:..
Human   255 SNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFH 319

  Fly   160 LFRGRQIKV--------MSKRTNRPGLS 179
            ...|::::|        .|:...:||.|
Human   320 DIMGKKVEVKRAEPRDSKSQAPGQPGAS 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488
RRM_II_PABPN1 97..172 CDD:409966 18/82 (22%)
DAZAP1XP_011526206.1 ELAV_HUD_SF <106..199 CDD:273741
RRM1_DAZAP1 154..235 CDD:409988
RRM2_DAZAP1 254..333 CDD:409765 17/77 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.