DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and rna15

DIOPT Version :10

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_593884.1 Gene:rna15 / 2543462 PomBaseID:SPAC644.16 Length:422 Species:Schizosaccharomyces pombe


Alignment Length:47 Identity:14/47 - (29%)
Similarity:25/47 - (53%) Gaps:0/47 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 VYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEF 144
            |||||:.|..:.|::...|...|.:....::.:...|.|||:.:.|:
pombe     7 VYVGNIPYEMAEEQVIDIFKQSGPVKSFQLVIDPESGQPKGYGFCEY 53

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488
RRM_II_PABPN1 97..172 CDD:409966 14/47 (30%)
rna15NP_593884.1 RRM_CSTF2_RNA15_like 5..80 CDD:409832 14/47 (30%)
CSTF2_hinge 150..222 CDD:433869
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.