DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and SPBC365.04c

DIOPT Version :9

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_596033.1 Gene:SPBC365.04c / 2540924 PomBaseID:SPBC365.04c Length:233 Species:Schizosaccharomyces pombe


Alignment Length:219 Identity:58/219 - (26%)
Similarity:93/219 - (42%) Gaps:33/219 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DQLLESLEETNGEQETEIATEVEEEGSMQIDPELEAIKARVKEMEEEAEKIKQMQSEVDKQMAGG 75
            |:..:||||             .|:...|.:.|||. ||..|...:|..: ||:....||.....
pombe    21 DKKSQSLEE-------------HEKKVQQKNEELEK-KAADKISRDELPE-KQLAQSNDKDKHSV 70

  Fly    76 STTGLATVPLSLEEKQEIDTRSV--YVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKG 138
            |.....|:. |..:|.:.:.|.|  :|||:...:|.|.|:.||...|.:..|.|..:|..|..||
pombe    71 SNPPHKTLK-SKRQKGKNNDRKVILFVGNLPKDSSVETLQLHFKRAGQVPSVRIPTDKTSGRQKG 134

  Fly   139 FAYIEF--GSKEFVETALAMNETLFRGRQIKV---------MSKRTNRPGLSTTNRFARGSFRGR 192
            :|::||  ...:.:..||..:.|:::.|:|.:         ...|.|:  :...||..:...|.|
pombe   135 YAFVEFINPKTDVISKALKFHHTIYKERKINIELTAGGGGKTEARMNK--IKEKNRKWKEEMRQR 197

  Fly   193 GARVSRACCHSTFRGARRAMGYRG 216
            .|...:.....  :.||:|:...|
pombe   198 VASEEQQAGEE--KMARKAVADEG 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 RRM <43..>172 CDD:223796 40/141 (28%)
RRM_II_PABPN1 97..172 CDD:240994 24/87 (28%)
SPBC365.04cNP_596033.1 RRM 18..229 CDD:223796 58/219 (26%)
RRM_Nop6 92..167 CDD:240846 24/74 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.