DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and Rnps1

DIOPT Version :9

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001073596.1 Gene:Rnps1 / 19826 MGIID:97960 Length:305 Species:Mus musculus


Alignment Length:58 Identity:15/58 - (25%)
Similarity:28/58 - (48%) Gaps:1/58 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 VYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGH-PKGFAYIEFGSKEFVETAL 154
            |::|.:....:.:.:...|...|.|..:.:...:...| .||:||:||.:.:..|.||
Mouse   163 VHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKAL 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 RRM <43..>172 CDD:223796 15/58 (26%)
RRM_II_PABPN1 97..172 CDD:240994 15/58 (26%)
Rnps1NP_001073596.1 Necessary for interaction with the cleaved p110 isoform of CDC2L1. /evidence=ECO:0000250 1..220 13/56 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..170 2/6 (33%)
Necessary for interaction with SRP54, nuclear localization and exon-skipping. /evidence=ECO:0000250 1..161
Necessary for interactions with UPF2 and UPF3B and UPF2-dependent NMD. /evidence=ECO:0000250 69..121
Necessary for interaction with PNN and exon-skipping. /evidence=ECO:0000250 156..242 15/58 (26%)
Interaction with SAP18 and ACIN1. /evidence=ECO:0000250 159..244 15/58 (26%)
RRM_RNPS1 163..236 CDD:409800 15/58 (26%)
Necessary for interaction with TRA2B, nuclear localization and exon-skipping. /evidence=ECO:0000250 238..305
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..305
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4209
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.