DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and Y57G11A.5

DIOPT Version :10

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_502757.2 Gene:Y57G11A.5 / 190364 WormBaseID:WBGene00013293 Length:110 Species:Caenorhabditis elegans


Alignment Length:65 Identity:20/65 - (30%)
Similarity:37/65 - (56%) Gaps:5/65 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LATVPLSLEEKQEIDTRSVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEF 144
            ::.:|.:.:.|:.::.|.|||||:.:.|:.:|:||.|...|.|..:.:.     ..|.|||::.|
 Worm     1 MSVIPQNRKRKRNVENRQVYVGNMPFDATEKEIEAVFSVMGPIKSIWMA-----KRPPGFAFVTF 60

  Fly   145  144
             Worm    61  60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488
RRM_II_PABPN1 97..172 CDD:409966 17/48 (35%)
Y57G11A.5NP_502757.2 RRM_SF 19..87 CDD:473069 17/47 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.