powered by:
Protein Alignment Pabp2 and Y51H4A.22
DIOPT Version :9
Sequence 1: | NP_476902.1 |
Gene: | Pabp2 / 35788 |
FlyBaseID: | FBgn0005648 |
Length: | 224 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_502979.2 |
Gene: | Y51H4A.22 / 190157 |
WormBaseID: | WBGene00013116 |
Length: | 283 |
Species: | Caenorhabditis elegans |
Alignment Length: | 46 |
Identity: | 16/46 - (34%) |
Similarity: | 24/46 - (52%) |
Gaps: | 7/46 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 VEEEGSMQIDPELEAIKARV---KEMEEE--AEKIKQMQSEVDKQM 72
|.|.| :|...|:.|..|. ::.||| |||::....:.|||:
Worm 18 VAEAG--KIHRHLKKIGKRFEKWEKTEEEVFAEKLQHWNEQTDKQV 61
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Pabp2 | NP_476902.1 |
RRM |
<43..>172 |
CDD:223796 |
12/35 (34%) |
RRM_II_PABPN1 |
97..172 |
CDD:240994 |
|
Y51H4A.22 | NP_502979.2 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4209 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.