DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and rsp-6

DIOPT Version :10

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_741446.1 Gene:rsp-6 / 177566 WormBaseID:WBGene00004703 Length:179 Species:Caenorhabditis elegans


Alignment Length:124 Identity:36/124 - (29%)
Similarity:51/124 - (41%) Gaps:30/124 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 VYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETAL-AMNETLF 161
            ||||.:...|:::|||..|...|.|.:|.:.     ..|.|||::|:......|.|: |::.:..
 Worm     5 VYVGGLPSDATSQELEEIFDRFGRIRKVWVA-----RRPPGFAFVEYDDVRDAEDAVRALDGSRI 64

  Fly   162 RGRQIKVMSKRTNRPGLSTTNRFA----RGSFRGRGARVSRACCHSTFRGARRAMGYRG 216
            .|.:.:|        .|||..|..    .|.|.|||.            |.|....|||
 Worm    65 CGVRARV--------ELSTGQRRGGGGRGGGFGGRGG------------GGRDRSPYRG 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488
RRM_II_PABPN1 97..172 CDD:409966 22/74 (30%)
rsp-6NP_741446.1 RRM_SRSF3_like 4..75 CDD:409808 23/82 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.