DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and sgnh-1

DIOPT Version :9

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_500666.2 Gene:sgnh-1 / 177260 WormBaseID:WBGene00020354 Length:177 Species:Caenorhabditis elegans


Alignment Length:180 Identity:65/180 - (36%)
Similarity:93/180 - (51%) Gaps:30/180 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 EEAEKIKQMQSEVDKQMAGGSTTGLATVPLSLEEKQEIDTRSVYVGNVDYGASAEELEAHFHGCG 120
            ||.|.:||..|...|.||.           :.||:::.|.|||||||||:.::..|:|.||..||
 Worm    17 EEMELLKQALSASKKYMAP-----------TAEEQEKTDARSVYVGNVDWKSTVSEIEEHFAVCG 70

  Fly   121 TINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMNETLFRGRQIKVMSKRTNRPGLSTT---- 181
            .:.||||..:|..|:.|.||::||...|.|:.||.::.|:||.|:|.|..||||:||:..|    
 Worm    71 KVARVTIPKDKFTGYQKNFAFVEFQKLESVQLALVLSGTMFRNRKIMVTLKRTNKPGMGRTATAQ 135

  Fly   182 --NRFARGSFRGRGAR-----VSRACCHSTFRGARRAMGYRGRANYYAPY 224
              ..||:.|....|:.     |.....::...|:        |:..:|||
 Worm   136 KPAHFAKSSHGKPGSHQGVTVVKYVYVNAPINGS--------RSKRFAPY 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 RRM <43..>172 CDD:223796 48/115 (42%)
RRM_II_PABPN1 97..172 CDD:240994 35/74 (47%)
sgnh-1NP_500666.2 RRM_II_PABPs 47..119 CDD:240752 34/71 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4209
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412946at2759
OrthoFinder 1 1.000 - - FOG0001228
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X689
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.