DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and cpf-2

DIOPT Version :10

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_499734.1 Gene:cpf-2 / 176742 WormBaseID:WBGene00000774 Length:336 Species:Caenorhabditis elegans


Alignment Length:101 Identity:28/101 - (27%)
Similarity:51/101 - (50%) Gaps:11/101 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 MAGG-STTGLATVPLSLEEKQEIDTRSVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGH 135
            |:|| .::|:.         .:...|||:|||:.|..|.:.:.:.|...|.:..:.::.::..|.
 Worm     2 MSGGYKSSGVG---------NDRSQRSVFVGNISYDVSEDTIRSIFSKAGNVLSIKMVHDRETGK 57

  Fly   136 PKGFAYIEFGSKEFVETALA-MNETLFRGRQIKVMS 170
            |||:.:|||...:..|.|:. :|.....||.::|.|
 Worm    58 PKGYGFIEFPDIQTAEVAIRNLNGYELSGRILRVDS 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488
RRM_II_PABPN1 97..172 CDD:409966 23/75 (31%)
cpf-2NP_499734.1 RRM_CSTF2_RNA15_like 18..94 CDD:409832 24/76 (32%)
CSTF2_hinge 115..194 CDD:433869
CSTF_C 299..334 CDD:464130
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.