DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and eif-3.G

DIOPT Version :10

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001263666.1 Gene:eif-3.G / 174346 WormBaseID:WBGene00001230 Length:262 Species:Caenorhabditis elegans


Alignment Length:117 Identity:31/117 - (26%)
Similarity:54/117 - (46%) Gaps:9/117 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 EMEEEAEKIKQMQSEVDKQMAGGSTTGLATVPLSLEEKQEIDTRSVYVGNVDYGASAEELEAHFH 117
            :::|||:..|  .:|.|:...|....|...      ::...|..:..|.|:....:.:||...|.
 Worm   147 QLDEEADADK--DTEKDRMAMGMRPDGRQI------DRNRSDENTCRVTNLPQEMNEDELRDLFG 203

  Fly   118 GCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALA-MNETLFRGRQIKV 168
            ..|.:.|:.|..:|..|.|||||::.|.|::....|:| :|:.......:||
 Worm   204 KIGRVIRIFIARDKVTGLPKGFAFVTFESRDDAARAIAELNDIRMYHMVLKV 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488 4/14 (29%)
RRM_II_PABPN1 97..172 CDD:409966 22/73 (30%)
eif-3.GNP_001263666.1 eIF3G 33..143 CDD:240597
RRM_eIF3G_like 183..257 CDD:409842 22/73 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.