DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and EEED8.12

DIOPT Version :9

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_495021.1 Gene:EEED8.12 / 173922 WormBaseID:WBGene00017140 Length:197 Species:Caenorhabditis elegans


Alignment Length:204 Identity:79/204 - (38%)
Similarity:108/204 - (52%) Gaps:33/204 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EEGSMQIDPELEAIKARVKEMEEEAEKIKQMQSEVDKQMAGGSTTGLATVPLSLEEKQEIDTRSV 98
            ||.|...:.|:||          |:..::|:|:::.|.:...     |.||.:.||::.||.:||
 Worm    14 EESSNSFEMEIEA----------ESAILEQIQNKMAKNLESA-----AYVPPTEEEQKAIDAKSV 63

  Fly    99 YVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMNETLFRG 163
            ::||||:.::.||:|.||.|||.|.|.||..:|.....|.||||||.....:|.||.||.:|||.
 Worm    64 FIGNVDFNSTIEEVEEHFKGCGHIVRTTIPKDKFTKKQKNFAYIEFDDSSSIENALVMNGSLFRS 128

  Fly   164 RQIKVMSKRTNRPGLSTTNR-FARGSF-RGRGAR-----------VSRACCHSTFRGARRAMGYR 215
            |.|.|.:||||.||:....| .:||:| |||||.           |.....:...||.|   |.|
 Worm   129 RPIVVTAKRTNIPGMGHGVRGSSRGTFGRGRGAARGAPGRQQTVVVKYVYVNGPNRGGR---GGR 190

  Fly   216 GRANYYAPY 224
            ||.  :.||
 Worm   191 GRR--FNPY 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 RRM <43..>172 CDD:223796 51/128 (40%)
RRM_II_PABPN1 97..172 CDD:240994 37/74 (50%)
EEED8.12NP_495021.1 RRM <11..>133 CDD:223796 53/133 (40%)
RRM_II_PABPs 62..134 CDD:240752 36/71 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4209
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53866
OrthoDB 1 1.010 - - D1412946at2759
OrthoFinder 1 1.000 - - FOG0001228
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X689
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.