DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and EEED8.4

DIOPT Version :9

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_495022.2 Gene:EEED8.4 / 173921 WormBaseID:WBGene00017135 Length:191 Species:Caenorhabditis elegans


Alignment Length:187 Identity:77/187 - (41%)
Similarity:104/187 - (55%) Gaps:25/187 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 EMEEEAEK--IKQMQSEVDKQMAGGSTTGLATVPLSLEEKQEIDTRSVYVGNVDYGASAEELEAH 115
            |||.|||.  ::|:|:::.|.:...     |.||.:.||::.||.:||::||||:.::.||:|.|
 Worm    15 EMEIEAESAILQQIQNKMAKHLESA-----AYVPPTEEEQKAIDAKSVFIGNVDFNSTIEEIEEH 74

  Fly   116 FHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMNETLFRGRQIKVMSKRTNRPGLST 180
            |.|||.|.:.||..:|.....|.||||||.....:|.||.||.:|||.|.|.|.:||||.||:..
 Worm    75 FKGCGQIVKTTIPKDKFTKKQKNFAYIEFDDSSSIENALVMNGSLFRSRPIVVTAKRTNIPGMGH 139

  Fly   181 TNR-FARGSF-RGRGAR-----------VSRACCHSTFRGARRAMGYRGRANYYAPY 224
            ..| .:||:| |||||.           |.....:...||.|   |.|||.  :.||
 Worm   140 GVRGSSRGTFGRGRGAARGAPGRQQTVVVKYVYVNGPNRGGR---GGRGRR--FNPY 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 RRM <43..>172 CDD:223796 52/120 (43%)
RRM_II_PABPN1 97..172 CDD:240994 36/74 (49%)
EEED8.4NP_495022.2 RRM <2..>127 CDD:223796 51/116 (44%)
RRM_II_PABPs 56..128 CDD:240752 35/71 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4209
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53866
OrthoDB 1 1.010 - - D1412946at2759
OrthoFinder 1 1.000 - - FOG0001228
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X689
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.