DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and rsp-4

DIOPT Version :10

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001379856.1 Gene:rsp-4 / 173915 WormBaseID:WBGene00004701 Length:196 Species:Caenorhabditis elegans


Alignment Length:121 Identity:35/121 - (28%)
Similarity:54/121 - (44%) Gaps:9/121 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 SVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMNE-TL 160
            |:.:.|:.|..:..:|...|...|.|..|.|..:|.....|||.::.|..:...|.||...: .|
 Worm    20 SLKIDNLSYQTTPNDLRRTFERYGDIGDVHIPRDKYSRQSKGFGFVRFYERRDAEHALDRTDGKL 84

  Fly   161 FRGRQIKVMSKRTNRPGLSTTNRFARGSFRGR-----GARVSRACCHSTFRGARRA 211
            ..||:::|...:.:||   :..|..||...||     ..|.||:..:|..|..||:
 Worm    85 VDGRELRVTLAKYDRP---SDERGGRGGGGGRRRSRSPRRRSRSPRYSRSRSPRRS 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488
RRM_II_PABPN1 97..172 CDD:409966 21/75 (28%)
rsp-4NP_001379856.1 RRM_SRSF2_SRSF8 21..93 CDD:409751 19/71 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.