DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and ZK1225.4

DIOPT Version :9

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_493316.1 Gene:ZK1225.4 / 173185 WormBaseID:WBGene00014238 Length:519 Species:Caenorhabditis elegans


Alignment Length:256 Identity:50/256 - (19%)
Similarity:85/256 - (33%) Gaps:97/256 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TEVEEEGS--------------MQIDPE-LEAIKARVKEMEE---EAEKI--------------K 62
            |::||.|:              .::||| ||.....:|.::|   ..:|:              |
 Worm   183 TKIEEVGACTEYGGVSLENTNLYELDPERLETRDKLLKHLQELFYTEQKVSEIPFDWIYSSASEK 247

  Fly    63 QMQSEVD-----KQMA-------------------GGSTTGLATVPLSLEEKQEID-TRSVYVGN 102
            :::.||.     |:||                   |.:...|..:...:.::.... |..|:||.
 Worm   248 ELKIEVCHGTELKKMAKKDFIKWWEWFQMMCRPVKGENEHTLVQITGGVYDRLVFRVTMLVHVGT 312

  Fly   103 VDYGASAE-----ELEAHFHGC--GTINRVTILC-----NKADGHPK-GFAYIE-FGSK------ 147
            .|...:.|     :.:...||.  ..||:..::|     .:||...| ...|.| .||:      
 Worm   313 EDIHPTEEFSFKLQFKYDVHGDKEWLINKFEVMCPTIAVPEADLMKKHALVYREIIGSRLQLMVN 377

  Fly   148 ------EFVETALAMNETLF-------RGRQIKVMSKRTNRPGLSTT----NRFARGSFRG 191
                  .|.|..:|:....:       :|.:   |.|.|:...|..|    |:...|...|
 Worm   378 NPELWYNFAEAIVALTSPTYEVENCAGKGEE---MEKGTDMYQLKHTFWKLNKDTHGRMEG 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 RRM <43..>172 CDD:223796 37/204 (18%)
RRM_II_PABPN1 97..172 CDD:240994 22/107 (21%)
ZK1225.4NP_493316.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4209
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.