DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and SC35

DIOPT Version :10

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_061513963.1 Gene:SC35 / 1279150 VectorBaseID:AGAMI1_006283 Length:167 Species:Anopheles gambiae


Alignment Length:112 Identity:35/112 - (31%)
Similarity:55/112 - (49%) Gaps:12/112 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 SVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETAL-AMNETL 160
            |:.|.|:.|..:.::|...|..||.:..:.|..::.....:|||::.|..|...|.|| ||:..:
Mosquito    16 SLKVDNLTYRTTPDDLRRVFERCGEVGDIYIPRDRHTRESRGFAFVRFYDKRDAEDALDAMDGRM 80

  Fly   161 FRGRQIKVMSKRTNRPGLSTT-----NRF---ARGSFRGRGARVSRA 199
            ..||:::|...|..||   |:     ||:   .||..|.|..|.||:
Mosquito    81 LDGRELRVQMARYGRP---TSPQRRGNRYNGRERGRSRERHRRRSRS 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488
RRM_II_PABPN1 97..172 CDD:409966 22/75 (29%)
SC35XP_061513963.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.